Nmr structure of the anemonia erythraea aetx-k toxin
PDB DOI: 10.2210/pdb7od2/pdb
Classification: TOXIN Organism(s): Anemonia Erythraea
Deposited: 2021-04-28 Deposition Author(s): Chill, J.H. , Qasim, A. , Qassem, N.
Nmr structure of the anemonia erythraea aetx-k toxin
Chill, J.H. , Qasim, A. , Qassem, N.
Primary Citation of Related Structures: 7OD2
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Kappa-actitoxin-Aer3a | A | 34 | Anemonia Erythraea | ACKDYLPKSECTQFRCRTSMKYKYTNCKKTCGTC |
Method: SOLUTION NMR
Deposited Date: 2021-04-28 Deposition Author(s): Chill, J.H. , Qasim, A. , Qassem, N.