Cryo-em structure of the plectasin fibril (single strand)
PDB DOI: 10.2210/pdb7oag/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Pseudoplectania Nigrella
Deposited: 2021-04-19 Deposition Author(s): Effantin, G.
Cryo-em structure of the plectasin fibril (single strand)
Primary Citation of Related Structures: 7OAG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fungal defensin plectasin | A | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | B | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | C | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | D | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | E | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | F | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | G | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | H | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | I | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | J | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | K | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | L | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | M | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | N | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | O | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | P | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | Q | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | R | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | S | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | T | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | U | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | V | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | W | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | X | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
| Fungal defensin plectasin | Y | 40 | Pseudoplectania Nigrella | GFGCNGPWSEDDMKCHNHCKSIKGYKGGYCAKGGFLCKCY |
Method: ELECTRON MICROSCOPY
Deposited Date: 2021-04-19 Deposition Author(s): Effantin, G.