Reversible supramolecular assembly of the anti-microbial peptide plectasin
PDB DOI: 10.2210/pdb7o76/pdb
Classification: ANTIMICROBIAL PROTEIN Organism(s): Pseudoplectania Nigrella
Deposited: 2021-04-13 Deposition Author(s): Harris, P. , Noergaard, N. , Pohl, C.
Method: X-RAY DIFFRACTION Resolution: 1.131 Å
Reversible supramolecular assembly of the anti-microbial peptide plectasin
Harris, P. , Noergaard, N. , Pohl, C.
Primary Citation of Related Structures: 7O76
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Fungal defensin plectasin | XXX | 40 | Pseudoplectania Nigrella | GFGCNGPWDEDDMQCHNHCKSIKGYKGGYCAKGGFVCKCY |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-04-13 Deposition Author(s): Harris, P. , Noergaard, N. , Pohl, C.