Crystal structure of unlinked ns2b-ns3 protease from zika virus in complex with inhibitor mi-2289
PDB DOI: 10.2210/pdb7o2m/pdb
Classification: VIRAL PROTEIN Organism(s): Zika Virus
Deposited: 2021-03-30 Deposition Author(s): Heine, A. , Huber, S. , Steinmetzer, T.
Crystal structure of unlinked ns2b-ns3 protease from zika virus in complex with inhibitor mi-2289
Heine, A. , Huber, S. , Steinmetzer, T.
Primary Citation of Related Structures: 7O2M
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Genome polyprotein | A | 53 | Zika Virus | MTGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEEDGPPMRE |
| Genome polyprotein | B | 178 | Zika Virus | GSGALWDVPAPKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKREEETPVE |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-03-30 Deposition Author(s): Heine, A. , Huber, S. , Steinmetzer, T.