Crystal structure of the epstein-barr virus protein zebra (bzlf1, zta) bound to a methylated dna duplex
PDB DOI: 10.2210/pdb7nx5/pdb
Classification: VIRAL PROTEIN Organism(s): Epstein-Barr Virus (Strain B95-8) , Synthetic Construct
Deposited: 2021-03-17 Deposition Author(s): Bernaudat, F. , Petosa, C.
Crystal structure of the epstein-barr virus protein zebra (bzlf1, zta) bound to a methylated dna duplex
Primary Citation of Related Structures: 7NX5
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Trans-activator protein BZLF1 | A | 63 | Epstein-Barr Virus (Strain B95-8) , Synthetic Construct | MLEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD |
Trans-activator protein BZLF1 | B | 63 | Epstein-Barr Virus (Strain B95-8) , Synthetic Construct | MLEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD |
Trans-activator protein BZLF1 | E | 63 | Epstein-Barr Virus (Strain B95-8) , Synthetic Construct | MLEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD |
Trans-activator protein BZLF1 | F | 63 | Epstein-Barr Virus (Strain B95-8) , Synthetic Construct | MLEIKRYKNRVASRKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-03-17 Deposition Author(s): Bernaudat, F. , Petosa, C.