S. aureus pepg1 nmr solution structure
PDB DOI: 10.2210/pdb7ns1/pdb
Classification: TOXIN Organism(s): N.A.
Deposited: 2021-03-05 Deposition Author(s): Felden, B. , Fermon, L. , Nonin-Lecomte, S. , Pinel-Marie, M.L.
S. aureus pepg1 nmr solution structure
Felden, B. , Fermon, L. , Nonin-Lecomte, S. , Pinel-Marie, M.L.
Primary Citation of Related Structures: 7NS1
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Snterotoxin A | A | 31 | N.A. | MITISTMLQFGLFLIALIGLVIKLIELSNKK |
Method: SOLUTION NMR
Deposited Date: 2021-03-05 Deposition Author(s): Felden, B. , Fermon, L. , Nonin-Lecomte, S. , Pinel-Marie, M.L.