Structure of sars-cov-2 papain-like protease plpro
PDB DOI: 10.2210/pdb7nfv/pdb
Classification: HYDROLASE Organism(s): Severe Acute Respiratory Syndrome Coronavirus 2
Deposited: 2021-02-07 Deposition Author(s): Alves Franca, B. , Andaleeb, H. , Awel, S. , Betzel, C. , Brings, L. , Brognaro, H. , Ehrt, C. , Ewert, W. , Falke, S. , Fleckenstein, H. , Galchenkova, M. , Gelisio, L. , Gevorkov, Y. , Ginn, H. , Groessler, M. , Gunther, S. , Han, H. , Hinrichs, W. , Koua, F. , Lane, T.J. , Li, C. , Lieske, J. , Lorenzen, K. , Meents, A. , Perbandt, M. , Perk, A. , Rarey, M. , Reinke, P. , Saouane, S. , Schmidt, C. , Schubert, R. , Schwinzer, M. , Sprenger, J. , Srinivasan, V. , Tolstikova, A. , Trost, F. , Ullah, N. , Wang, M. , Werner, N. , Yefanov, O.
Structure of sars-cov-2 papain-like protease plpro
Alves Franca, B. , Andaleeb, H. , Awel, S. , Betzel, C. , Brings, L. , Brognaro, H. , Ehrt, C. , Ewert, W. , Falke, S. , Fleckenstein, H. , Galchenkova, M. , Gelisio, L. , Gevorkov, Y. , Ginn, H. , Groessler, M. , Gunther, S. , Han, H. , Hinrichs, W. , Koua, F. , Lane, T.J. , Li, C. , Lieske, J. , Lorenzen, K. , Meents, A. , Perbandt, M. , Perk, A. , Rarey, M. , Reinke, P. , Saouane, S. , Schmidt, C. , Schubert, R. , Schwinzer, M. , Sprenger, J. , Srinivasan, V. , Tolstikova, A. , Trost, F. , Ullah, N. , Wang, M. , Werner, N. , Yefanov, O.
Primary Citation of Related Structures: 7NFV
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Papain-like protease nsp3 | AAA | 315 | Severe Acute Respiratory Syndrome Coronavirus 2 | EVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQIPCTCGKQATKYLVQQESPFVMMSAPPAQYELKHGTFTCASEYTGNYQCGHYKHITSKETLYCIDGALLTKSSEYKGPITDVFYKENSYTTTIK |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-02-07 Deposition Author(s): Alves Franca, B. , Andaleeb, H. , Awel, S. , Betzel, C. , Brings, L. , Brognaro, H. , Ehrt, C. , Ewert, W. , Falke, S. , Fleckenstein, H. , Galchenkova, M. , Gelisio, L. , Gevorkov, Y. , Ginn, H. , Groessler, M. , Gunther, S. , Han, H. , Hinrichs, W. , Koua, F. , Lane, T.J. , Li, C. , Lieske, J. , Lorenzen, K. , Meents, A. , Perbandt, M. , Perk, A. , Rarey, M. , Reinke, P. , Saouane, S. , Schmidt, C. , Schubert, R. , Schwinzer, M. , Sprenger, J. , Srinivasan, V. , Tolstikova, A. , Trost, F. , Ullah, N. , Wang, M. , Werner, N. , Yefanov, O.