Prx in complex with comr dna-binding domain
PDB DOI: 10.2210/pdb7n1n/pdb
Classification: VIRAL PROTEIN/TRANSCRIPTION Organism(s): Streptococcus Mutans Serotype C (Strain Atcc 700610 / Ua159) , Streptococcus Pyogenes Serotype M3 (Strain Atcc Baa-595 / Mgas315)
Deposited: 2021-05-27 Deposition Author(s): Prehna, G. , Rutbeek, N.R.
Method: X-RAY DIFFRACTION Resolution: 1.6 Å
Prx in complex with comr dna-binding domain
Primary Citation of Related Structures: 7N1N
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Prx | A | 68 | Streptococcus Mutans Serotype C (Strain Atcc 700610 / Ua159) , Streptococcus Pyogenes Serotype M3 (Strain Atcc Baa-595 / Mgas315) | MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDKLEHHHHHH |
ComR | B | 68 | Streptococcus Mutans Serotype C (Strain Atcc 700610 / Ua159) , Streptococcus Pyogenes Serotype M3 (Strain Atcc Baa-595 / Mgas315) | MLKDFGKKIKSLRLEKGLTKEAVCLDESQLSTRQLTRIESGQSTPTLNKAVYIAGRLGVTLGYLTDGE |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-05-27 Deposition Author(s): Prehna, G. , Rutbeek, N.R.