Co-crystal structure of prx with comr dna binding domain
PDB DOI: 10.2210/pdb7n10/pdb
Classification: VIRAL PROTEIN/TRANSCRIPTION Organism(s): Streptococcus Mutans Serotype C (Strain Atcc 700610 / Ua159) , Streptococcus Pyogenes Serotype M3 (Strain Atcc Baa-595 / Mgas315)
Deposited: 2021-05-26 Deposition Author(s): Prehna, G. , Rutbeek, N.R.
Method: X-RAY DIFFRACTION Resolution: 1.65 Å
Co-crystal structure of prx with comr dna binding domain
Primary Citation of Related Structures: 7N10
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Prx | A | 68 | Streptococcus Mutans Serotype C (Strain Atcc 700610 / Ua159) , Streptococcus Pyogenes Serotype M3 (Strain Atcc Baa-595 / Mgas315) | MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDKLEHHHHHH |
| Prx | C | 68 | Streptococcus Mutans Serotype C (Strain Atcc 700610 / Ua159) , Streptococcus Pyogenes Serotype M3 (Strain Atcc Baa-595 / Mgas315) | MLYIDEFKEAIDKGYILGDTVAIVRKNGKIFDYVLPHEKVRDDEVVTVERVEEVMVELDKLEHHHHHH |
| ComR | B | 69 | Streptococcus Mutans Serotype C (Strain Atcc 700610 / Ua159) , Streptococcus Pyogenes Serotype M3 (Strain Atcc Baa-595 / Mgas315) | GSHMLKDFGKKIKSLRLEKGLTKEAVCLDESQLSTRQLTRIESGQSTPTLNKAVYIAGRLGVTLGYLTD |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-05-26 Deposition Author(s): Prehna, G. , Rutbeek, N.R.