7MY8
Fusion peptide of sars-cov-2 spike rearranges into a wedge inserted in bilayered micelles
PDB DOI: 10.2210/pdb7my8/pdb
Classification: LIPID BINDING PROTEIN Organism(s): Severe Acute Respiratory Syndrome Coronavirus 2
Deposited: 2021-05-20 Deposition Author(s): Fulcher, Y.G. , Koppisetti, R.K. , Van Doren, S.R.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Fusion peptide of sars-cov-2 spike rearranges into a wedge inserted in bilayered micelles
Fulcher, Y.G. , Koppisetti, R.K. , Van Doren, S.R.
Primary Citation of Related Structures: 7MY8
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Spike protein S2 | A | 42 | Severe Acute Respiratory Syndrome Coronavirus 2 | SFIEDLLFNKVTLADAGFIKQYGDCLGDVAARDLICAQKFNG |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2021-05-20 Deposition Author(s): Fulcher, Y.G. , Koppisetti, R.K. , Van Doren, S.R.