Solution nmr structure of hdmx in complex with zn and mco-52-2
PDB DOI: 10.2210/pdb7mla/pdb
Classification: LIGASE Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-04-28 Deposition Author(s): Camarero, J.C. , Chaudhuri, D. , Ramirez, L.S. , Shekhtman, A. , Theophall, G.
Method: SOLUTION NMR Resolution: N.A.
Solution nmr structure of hdmx in complex with zn and mco-52-2
Camarero, J.C. , Chaudhuri, D. , Ramirez, L.S. , Shekhtman, A. , Theophall, G.
Primary Citation of Related Structures: 7MLA
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Protein Mdm4 | A | 70 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSHMYSGEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKEIQLVIKVFIA |
MCo-52-2 | B | 34 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GGVCPNLYLLCRRDSDCPGACICRHDSYCGSGSD |
Method: SOLUTION NMR
Deposited Date: 2021-04-28 Deposition Author(s): Camarero, J.C. , Chaudhuri, D. , Ramirez, L.S. , Shekhtman, A. , Theophall, G.