Crystal structure of the gh12 domain from acidothermus cellulolyticus guxa
PDB DOI: 10.2210/pdb7mkr/pdb
Classification: HYDROLASE Organism(s): Acidothermus Cellulolyticus
Deposited: 2021-04-26 Deposition Author(s): Lunin, V.V.
Crystal structure of the gh12 domain from acidothermus cellulolyticus guxa
Primary Citation of Related Structures: 7MKR
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Glycoside hydrolase, family 6 | AAA | 244 | Acidothermus Cellulolyticus | GTTVTDCTPGPNQNGVTSVQGDEYRVQTNEWNSSAQQCLTINTATGAWTVSTANFSGGTGGAPATYPSIYKGCHWGNCTTKNVGMPIQISQIGSAVTSWSTTQVSSGAYDVAYDIWTNSTPTTTGQPNGTEIMIWLNSRGGVQPFGSQTATGVTVAGHTWNVWQGQQTSWKIISYVLTPGATSISNLDLKAIFADAAARGSLNTSDYLLDVEAGFEIWQGGQGLGSNSFSVSVTSGSAHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-04-26 Deposition Author(s): Lunin, V.V.