Crystal structure of the hmg-c1 domain of human capicua bound to dna
PDB DOI: 10.2210/pdb7m5w/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2021-03-25 Deposition Author(s): Dowling, D.P. , Gnann, A.D. , Liew, J.J.M. , Webb, J.P.
Crystal structure of the hmg-c1 domain of human capicua bound to dna
Dowling, D.P. , Gnann, A.D. , Liew, J.J.M. , Webb, J.P.
Primary Citation of Related Structures: 7M5W
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protein capicua homolog | A | 186 | Homo Sapiens , Synthetic Construct | MGSSHHHHHHSSGLVPRGSHMDGRSPNKREKDHIRRPMNAFMIFSKRHRALVHQRHPNQDNRTVSKILGEWWYALGPKEKQKYHDLAFQVKEAHFKAHPDWKWCNKDRKKSSSEFKVPYSSLRRTLDQRRALVMQLFQDHGFFPSAQATAAFQARYADIFPSKVCLQLKIREVRQKIMQAATPTEQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-03-25 Deposition Author(s): Dowling, D.P. , Gnann, A.D. , Liew, J.J.M. , Webb, J.P.