Crystal structure of human mpp8 chromodomain in complex with peptidomimetic ligand unc5246
PDB DOI: 10.2210/pdb7m5u/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2021-03-24 Deposition Author(s): Budziszewski, G.R. , James, L.I. , Mcginty, R.K. , Norris, J.L. , Waybright, J.M.
Method: X-RAY DIFFRACTION Resolution: 2.02 Å
Crystal structure of human mpp8 chromodomain in complex with peptidomimetic ligand unc5246
Budziszewski, G.R. , James, L.I. , Mcginty, R.K. , Norris, J.L. , Waybright, J.M.
Primary Citation of Related Structures: 7M5U
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| M-phase phosphoprotein 8 | A | 62 | Homo Sapiens , Synthetic Construct | GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKAK |
| UNC5246 | B | 7 | Homo Sapiens , Synthetic Construct | XFAFXSX |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-03-24 Deposition Author(s): Budziszewski, G.R. , James, L.I. , Mcginty, R.K. , Norris, J.L. , Waybright, J.M.