Crystal structure of n2, a member of 4-oxalocrotonate tautomerase (4-ot) family
PDB DOI: 10.2210/pdb7m59/pdb
Classification: ISOMERASE Organism(s): Gammaproteobacteria Bacterium Sg8_31
Deposited: 2021-03-23 Deposition Author(s): Medellin, B.P. , Moreno, R.Y. , Zhang, Y.J.
Method: X-RAY DIFFRACTION Resolution: 1.65 Å
Crystal structure of n2, a member of 4-oxalocrotonate tautomerase (4-ot) family
Medellin, B.P. , Moreno, R.Y. , Zhang, Y.J.
Primary Citation of Related Structures: 7M59
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tautomerase domain-containing protein | A | 64 | Gammaproteobacteria Bacterium Sg8_31 | PVIQCDIRQGRTAEQKQAMAEAITRAVHETIGAPVEYIYVLIRETPGAHHVKAGRTLPEYTGDG |
| Tautomerase domain-containing protein | B | 64 | Gammaproteobacteria Bacterium Sg8_31 | PVIQCDIRQGRTAEQKQAMAEAITRAVHETIGAPVEYIYVLIRETPGAHHVKAGRTLPEYTGDG |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-03-23 Deposition Author(s): Medellin, B.P. , Moreno, R.Y. , Zhang, Y.J.