Phf2 phd domain complexed with peptide from n-terminus of vrk1
PDB DOI: 10.2210/pdb7m10/pdb
Classification: PROTEIN BINDING Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-03-11 Deposition Author(s): Cheng, X. , Horton, J.R.
Phf2 phd domain complexed with peptide from n-terminus of vrk1
Primary Citation of Related Structures: 7M10
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Lysine-specific demethylase PHF2 | A | 74 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSINMATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHK |
Serine/threonine-protein kinase VRK1 N-terminus peptide | B | 12 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | PRVKAAQAGRQS |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-03-11 Deposition Author(s): Cheng, X. , Horton, J.R.