PDBi (Protein Data Bank in India)

All in One Protein Databank
Home About Help Resources External Links Contact Us
Advanced Search
FASTA Sequence PDB Format mmCIF Format
FASTA Sequence PDB Format PDB Format(gz) PDBx/mmCIF Format PDBx/mmCIF Format(gz) PDBML/XML Format Validation Full PDF Validation CIF

7LP2

Structure of nedd4l ww3 domain

PDB DOI: 10.2210/pdb7lp2/pdb

Classification: LIGASE
Organism(s): Homo Sapiens , Synthetic Construct

Deposited: 2021-02-11
Deposition Author(s): Alam, S.L. , Alian, A. , Rheinemann, L. , Sundquist, W.I. , Thompson, T.

Experimental Data Snapshot

Method: X-RAY DIFFRACTION
Resolution: 1.88 Å

Literature

Structure of nedd4l ww3 domain

Alam, S.L. , Alian, A. , Rheinemann, L. , Sundquist, W.I. , Thompson, T.

Primary Citation of Related Structures: 7LP2


Proteins
Molecule Chains Sequence Length Organism Sequence
E3 ubiquitin-protein ligase A 38 Homo Sapiens , Synthetic Construct QPHMPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIM
E3 ubiquitin-protein ligase C 38 Homo Sapiens , Synthetic Construct QPHMPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIM
E3 ubiquitin-protein ligase E 38 Homo Sapiens , Synthetic Construct QPHMPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIM
Angiomotin B 15 Homo Sapiens , Synthetic Construct MEHRGPPPEYPFKGM
Angiomotin D 15 Homo Sapiens , Synthetic Construct MEHRGPPPEYPFKGM
Angiomotin F 15 Homo Sapiens , Synthetic Construct MEHRGPPPEYPFKGM
Experimental Data

Method: X-RAY DIFFRACTION

Deposited Date: 2021-02-11
Deposition Author(s): Alam, S.L. , Alian, A. , Rheinemann, L. , Sundquist, W.I. , Thompson, T.