Crystal structure of phf1 tudor domain in complex with a peptidomimetic ligand unc6641
PDB DOI: 10.2210/pdb7lky/pdb
Classification: Transcription/Transcription Inhibitor Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2021-02-03 Deposition Author(s): Kutateladze, T.G. , Liu, J.
Crystal structure of phf1 tudor domain in complex with a peptidomimetic ligand unc6641
Primary Citation of Related Structures: 7LKY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Isoform 1 of PHD finger protein 1 | A | 64 | Homo Sapiens , Synthetic Construct | GPLGRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEE |
Isoform 1 of PHD finger protein 1 | B | 64 | Homo Sapiens , Synthetic Construct | GPLGRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEE |
Isoform 1 of PHD finger protein 1 | C | 64 | Homo Sapiens , Synthetic Construct | GPLGRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEE |
Isoform 1 of PHD finger protein 1 | D | 64 | Homo Sapiens , Synthetic Construct | GPLGRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEE |
Isoform 1 of PHD finger protein 1 | E | 64 | Homo Sapiens , Synthetic Construct | GPLGRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEE |
Isoform 1 of PHD finger protein 1 | F | 64 | Homo Sapiens , Synthetic Construct | GPLGRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEE |
Isoform 1 of PHD finger protein 1 | G | 64 | Homo Sapiens , Synthetic Construct | GPLGRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEE |
Isoform 1 of PHD finger protein 1 | H | 64 | Homo Sapiens , Synthetic Construct | GPLGRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEE |
Peptidomimetic inhibitor UNC6641 | J | 8 | Homo Sapiens , Synthetic Construct | GGVXKPLR |
Peptidomimetic inhibitor UNC6641 | I | 8 | Homo Sapiens , Synthetic Construct | GGVXKPLR |
Peptidomimetic inhibitor UNC6641 | K | 8 | Homo Sapiens , Synthetic Construct | GGVXKPLR |
Peptidomimetic inhibitor UNC6641 | L | 8 | Homo Sapiens , Synthetic Construct | GGVXKPLR |
Peptidomimetic inhibitor UNC6641 | M | 8 | Homo Sapiens , Synthetic Construct | GGVXKPLR |
Peptidomimetic inhibitor UNC6641 | N | 8 | Homo Sapiens , Synthetic Construct | GGVXKPLR |
Peptidomimetic inhibitor UNC6641 | O | 8 | Homo Sapiens , Synthetic Construct | GGVXKPLR |
Peptidomimetic inhibitor UNC6641 | P | 8 | Homo Sapiens , Synthetic Construct | GGVXKPLR |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-02-03 Deposition Author(s): Kutateladze, T.G. , Liu, J.