Caenorhabditis elegans swsn-4 (smarca4-brg1) atpase bromodomain in complex with a modified histone h3, n6-epsilon-acetyl-l-lysine 14 (h3k14ac) polypeptide
PDB DOI: 10.2210/pdb7lhy/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-01-26 Deposition Author(s): Enriquez, P. , Rose, R.B.
Caenorhabditis elegans swsn-4 (smarca4-brg1) atpase bromodomain in complex with a modified histone h3, n6-epsilon-acetyl-l-lysine 14 (h3k14ac) polypeptide
Primary Citation of Related Structures: 7LHY
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
SWI/SNF nucleosome remodeling complex component | A | 123 | Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GPKKTDPELAEKINEMLDVILEYKNEDGELIADVFQTLPTRKELPDYYQVISKPMDFDRINKKIETGRYTVMEELNDDMNLLVNNAQTYNEEGSEIYVSSETIGKLWKEQYDKFMNPPKPVEE |
H3(7-20)K14ac | B | 14 | Human Herpesvirus 6B (Strain Hst) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ARKSTGGKAPRKQL |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-01-26 Deposition Author(s): Enriquez, P. , Rose, R.B.