Advanced Search:
7LH9
Crystal structure of brpf2 pwwp domain in complex with dna
PDB DOI: 10.2210/pdb7lh9/pdb
Classification: DNA BINDING PROTEIN/DNA Organism(s): Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-01-21 Deposition Author(s): Arrowsmith, C.H. , Dong, A. , Edwards, A.M. , Hughes, T.R. , Lei, M. , Li, Y. , Liu, J. , Loppnau, P. , Min, J. , Qin, S. , Structural Genomics Consortium (Sgc) , Yang, A. , Zhang, M.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.6 Å
Crystal structure of brpf2 pwwp domain in complex with dna
Arrowsmith, C.H. , Dong, A. , Edwards, A.M. , Hughes, T.R. , Lei, M. , Li, Y. , Liu, J. , Loppnau, P. , Min, J. , Qin, S. , Structural Genomics Consortium (Sgc) , Yang, A. , Zhang, M.
Primary Citation of Related Structures: 7LH9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Bromodomain-containing protein 1 | A | 126 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGE |
| Bromodomain-containing protein 1 | B | 126 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGE |
| Bromodomain-containing protein 1 | C | 126 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGE |
| Bromodomain-containing protein 1 | D | 126 | Salmonella Enterica , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | GSVLEPLKVVWAKCSGYPSYPALIIDPKMPRVPGHHNGVTIPAPPLDVLKIGEHMQTKSDEKLFLVLFFDNKRSWQWLPKSKMVPLGIDETIDKLKMMEGRNSSIRKAVRIAFDRAMNHLSRVHGE |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2021-01-21 Deposition Author(s): Arrowsmith, C.H. , Dong, A. , Edwards, A.M. , Hughes, T.R. , Lei, M. , Li, Y. , Liu, J. , Loppnau, P. , Min, J. , Qin, S. , Structural Genomics Consortium (Sgc) , Yang, A. , Zhang, M.