Structural characterization of two b-ktx scorpion toxins. one of them blocks human kcnq1 potassium channels
PDB DOI: 10.2210/pdb7lgl/pdb
Classification: TOXIN Organism(s): Tityus Costatus
Deposited: 2021-01-20 Deposition Author(s): Del Rio-Portilla, F. , Lopez-Giraldo, A.E.
Method: SOLUTION NMR Resolution: N.A.
Structural characterization of two b-ktx scorpion toxins. one of them blocks human kcnq1 potassium channels
Del Rio-Portilla, F. , Lopez-Giraldo, A.E.
Primary Citation of Related Structures: 7LGL
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Potassium channel toxin TcoKIK | A | 47 | Tityus Costatus | KIKSGWERLTSESEYACPAIDKFCEDHCAAKKAVGKCDDFKCNCIKL |
Method: SOLUTION NMR
Deposited Date: 2021-01-20 Deposition Author(s): Del Rio-Portilla, F. , Lopez-Giraldo, A.E.