Nmr solution structure of nav1.5 div s3b-s4a paddle motif in dpc micelle
PDB DOI: 10.2210/pdb7l83/pdb
Classification: MEMBRANE PROTEIN Organism(s): Salmonella Enterica
Deposited: 2020-12-30 Deposition Author(s): Arshava, B. , Bhuiyan, M.H. , Hussein, A.K. , Poget, S.F. , Zhuang, J.
Nmr solution structure of nav1.5 div s3b-s4a paddle motif in dpc micelle
Arshava, B. , Bhuiyan, M.H. , Hussein, A.K. , Poget, S.F. , Zhuang, J.
Primary Citation of Related Structures: 7L83
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Sodium channel protein type 5 subunit alpha | A | 37 | Salmonella Enterica | VVVILSIVGTVLSDIIQKYFFSPTLFRVIRLARIGRI |
Method: SOLUTION NMR
Deposited Date: 2020-12-30 Deposition Author(s): Arshava, B. , Bhuiyan, M.H. , Hussein, A.K. , Poget, S.F. , Zhuang, J.