Fe-s cluster-bound transcription activator whib7 in complex with the sigmaar4-rnap beta flap tip chimera
PDB DOI: 10.2210/pdb7kug/pdb
Classification: TRANSCRIPTION Organism(s): Mycobacterium Tuberculosis , Mycobacterium Tuberculosis (Strain Atcc 25618 / H37Rv)
Deposited: 2020-11-24 Deposition Author(s): Beltran, D.G. , Horova, M. , Li, S.R. , Wan, T. , Zhang, L.M.
Method: X-RAY DIFFRACTION Resolution: 1.55 Å
Fe-s cluster-bound transcription activator whib7 in complex with the sigmaar4-rnap beta flap tip chimera
Beltran, D.G. , Horova, M. , Li, S.R. , Wan, T. , Zhang, L.M.
Primary Citation of Related Structures: 7KUG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Probable transcriptional regulator WhiB7 | A | 79 | Mycobacterium Tuberculosis , Mycobacterium Tuberculosis (Strain Atcc 25618 / H37Rv) | MSVLTVPRQTPRQRLPVLPCHVGDPDMWFADTPAGLEVAKTMCVSCPIRRQCLAAALQRAEPWGVWGGEIFDQGSIVSH |
| Probable transcriptional regulator WhiB7 | C | 79 | Mycobacterium Tuberculosis , Mycobacterium Tuberculosis (Strain Atcc 25618 / H37Rv) | MSVLTVPRQTPRQRLPVLPCHVGDPDMWFADTPAGLEVAKTMCVSCPIRRQCLAAALQRAEPWGVWGGEIFDQGSIVSH |
| RNA polymerase sigma factor, DNA-directed RNA polymerase subunit beta chimera | B | 112 | Mycobacterium Tuberculosis , Mycobacterium Tuberculosis (Strain Atcc 25618 / H37Rv) | MAHHHHHHVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLDGSSGSGTPEERLLRAIFGEKA |
| RNA polymerase sigma factor, DNA-directed RNA polymerase subunit beta chimera | D | 112 | Mycobacterium Tuberculosis , Mycobacterium Tuberculosis (Strain Atcc 25618 / H37Rv) | MAHHHHHHVAVDAVSFTLLQDQLQSVLDTLSEREAGVVRLRFGLTDGQPRTLDEIGQVYGVTRERIRQIESKTMSKLRHPSRSQVLRDYLDGSSGSGTPEERLLRAIFGEKA |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-11-24 Deposition Author(s): Beltran, D.G. , Horova, M. , Li, S.R. , Wan, T. , Zhang, L.M.