Mif y99c homotrimeric mutant
PDB DOI: 10.2210/pdb7kqx/pdb
Classification: ISOMERASE Organism(s): Homo Sapiens
Deposited: 2020-11-18 Deposition Author(s): Georgios, P. , Lolis, E.J. , Manjula, R.
Mif y99c homotrimeric mutant
Georgios, P. , Lolis, E.J. , Manjula, R.
Primary Citation of Related Structures: 7KQX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Macrophage migration inhibitory factor | A | 114 | Homo Sapiens | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYCDMNAANVGWNNSTFA |
| Macrophage migration inhibitory factor | B | 114 | Homo Sapiens | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYCDMNAANVGWNNSTFA |
| Macrophage migration inhibitory factor | C | 114 | Homo Sapiens | PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYCDMNAANVGWNNSTFA |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-11-18 Deposition Author(s): Georgios, P. , Lolis, E.J. , Manjula, R.