7KN0
Structure of the integrin aiib(w968v)b3 transmembrane complex
PDB DOI: 10.2210/pdb7kn0/pdb
Classification: CELL ADHESION Organism(s): Salmonella Enterica
Deposited: 2020-11-03 Deposition Author(s): An, W. , Kim, C. , Kim, J. , Situ, A.J. , Ulmer, T.S.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Structure of the integrin aiib(w968v)b3 transmembrane complex
An, W. , Kim, C. , Kim, J. , Situ, A.J. , Ulmer, T.S.
Primary Citation of Related Structures: 7KN0
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Integrin alpha-IIb | A | 43 | Salmonella Enterica | GALEERCGIPIWVVLVGVLGGLLLLTILVLAMWKVGFFKRNRP |
| Integrin beta-3 | B | 44 | Salmonella Enterica | GESPKCGPDILVVLLSVMGAILLIGLAALLIWKLLITIHDRKEF |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2020-11-03 Deposition Author(s): An, W. , Kim, C. , Kim, J. , Situ, A.J. , Ulmer, T.S.