Crystal structure of bacillus halodurans oapb (native) at 1.2 a
PDB DOI: 10.2210/pdb7k9b/pdb
Classification: RNA BINDING PROTEIN Organism(s): Bacillus Halodurans (Strain Atcc Baa-125 / Dsm 18197 / Ferm 7344 / Jcm 9153 / C-125)
Deposited: 2020-09-29 Deposition Author(s): Breaker, R.R. , Yang, Y.
Method: X-RAY DIFFRACTION Resolution: 1.202 Å
Crystal structure of bacillus halodurans oapb (native) at 1.2 a
Primary Citation of Related Structures: 7K9B
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| OLE-associated protein B | A | 98 | Bacillus Halodurans (Strain Atcc Baa-125 / Dsm 18197 / Ferm 7344 / Jcm 9153 / C-125) | GPSPEIGQIVKIVKGRDRDQFSVIIKRVDDRFVYIADGDKRKVDRAKRKNMNHLKLIDHISPEVRHSFEETGKVTNGKLRFALKKFLEEHADLLKEGE |
| OLE-associated protein B | B | 98 | Bacillus Halodurans (Strain Atcc Baa-125 / Dsm 18197 / Ferm 7344 / Jcm 9153 / C-125) | GPSPEIGQIVKIVKGRDRDQFSVIIKRVDDRFVYIADGDKRKVDRAKRKNMNHLKLIDHISPEVRHSFEETGKVTNGKLRFALKKFLEEHADLLKEGE |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-29 Deposition Author(s): Breaker, R.R. , Yang, Y.