Crystal structure of human cpsf30 in complex with hfip1
PDB DOI: 10.2210/pdb7k95/pdb
Classification: NUCLEAR PROTEIN Organism(s): Homo Sapiens
Deposited: 2020-09-28 Deposition Author(s): Hamilton, K. , Tong, L.
Crystal structure of human cpsf30 in complex with hfip1
Primary Citation of Related Structures: 7K95
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Isoform 2 of Cleavage and polyadenylation specificity factor subunit 4 | A | 60 | Homo Sapiens | HIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPM |
Pre-mRNA 3'-end-processing factor FIP1 | B | 42 | Homo Sapiens | SFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE |
Pre-mRNA 3'-end-processing factor FIP1 | C | 42 | Homo Sapiens | SFEDKPWRKPGADLSDYFNYGFNEDTWKAYCEKQKRIRMGLE |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-28 Deposition Author(s): Hamilton, K. , Tong, L.