Solution structure of the corynebacterium diphtheriae spaa pilin-signal peptide complex
PDB DOI: 10.2210/pdb7k7f/pdb
Classification: CELL ADHESION Organism(s): Mytilus Galloprovincialis , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-09-22 Deposition Author(s): Clubb, R.T. , Mcconnell, S.A.
Solution structure of the corynebacterium diphtheriae spaa pilin-signal peptide complex
Primary Citation of Related Structures: 7K7F
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Putative surface-anchored fimbrial subunit | A | 143 | Mytilus Galloprovincialis , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | ERTSIAVHALMGLPTGQPANGTKLDSIGLPKVDGMSFTLYRVNEIDLTTQAGWDAASKIKLEELYTNGHPTDKVTKVATKKTEGGVAKFDNLTPALYLVVQELNGAEAVVRSQPFLVAAPQTNPTGDGWLQDVHVYPKHQALS |
SpaA sorting signal peptide | B | 10 | Mytilus Galloprovincialis , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | KNAGFELPLT |
Method: SOLUTION NMR
Deposited Date: 2020-09-22 Deposition Author(s): Clubb, R.T. , Mcconnell, S.A.