Cftr associated ligand (cal) pdz domain bound to peptidomimetic lycalpmb
PDB DOI: 10.2210/pdb7jzq/pdb
Classification: PEPTIDE BINDING PROTEIN Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2020-09-02 Deposition Author(s): Gill, N.P. , Madden, D.R.
Method: X-RAY DIFFRACTION Resolution: 1.35 Å
Cftr associated ligand (cal) pdz domain bound to peptidomimetic lycalpmb
Primary Citation of Related Structures: 7JZQ
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Golgi-associated PDZ and coiled-coil motif-containing protein | A | 87 | Homo Sapiens , Synthetic Construct | GPIRKVLLLKEDHEGLGISITGGKEHGVPILISEIHPGQPADRCGGLHVGDAILAVNGVNLRDTKHKEAVTILSQQRGEIEFEVVYV |
LyCALPMB peptide core | C | 10 | Homo Sapiens , Synthetic Construct | ANSRLPTSKI |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-02 Deposition Author(s): Gill, N.P. , Madden, D.R.