The external aldimine crystal structure of salmonella typhimurium tryptophan synthase mutant beta-s377a in complex with cesium ion at the metal coordination site. the single beta-q114 rotamer conformation allows a hydrogen bond to form with the plp oxygen at the position 3 in the ring
PDB DOI: 10.2210/pdb7jqw/pdb
Classification: LYASE/LYASE INHIBITOR Organism(s): Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720)
Deposited: 2020-08-11 Deposition Author(s): Dunn, M.F. , Hilario, E. , Mueller, L.J.
The external aldimine crystal structure of salmonella typhimurium tryptophan synthase mutant beta-s377a in complex with cesium ion at the metal coordination site. the single beta-q114 rotamer conformation allows a hydrogen bond to form with the plp oxygen at the position 3 in the ring
Dunn, M.F. , Hilario, E. , Mueller, L.J.
Primary Citation of Related Structures: 7JQW
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Tryptophan synthase alpha chain | A | 268 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA |
| Tryptophan synthase beta chain | B | 397 | Salmonella Typhimurium (Strain Lt2 / Sgsc1412 / Atcc 700720) | MTTLLNPYFGEFGGMYVPQILMPALNQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALTKCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKSEIIAETGAGQHGVASALASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSYETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGMFADFINDTSVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTADGQIEESYSISAGLDFPSVGPQHAYLNSIGRADYVSITDDEALEAFKTLCRHEGIIPALESSHALAHALKMMREQPEKEQLLVVNLAGRGDKDIFTVHDILKARGEI |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-08-11 Deposition Author(s): Dunn, M.F. , Hilario, E. , Mueller, L.J.