Carbonic anhydrase ix mimic complexed with n-(5-sulfamoyl-1,3,4-thiadiazol-2-yl)cyclohexanecarboxamide
PDB DOI: 10.2210/pdb7job/pdb
Classification: LYASE/INHIBITOR Organism(s): Homo Sapiens
Deposited: 2020-08-06 Deposition Author(s): Andring, J.T. , Mckenna, R.
Carbonic anhydrase ix mimic complexed with n-(5-sulfamoyl-1,3,4-thiadiazol-2-yl)cyclohexanecarboxamide
Primary Citation of Related Structures: 7JOB
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Carbonic anhydrase 2 | A | 260 | Homo Sapiens | MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHSFQVTFDDSQDKAVLKGGPLDGTYRLLQFHFHWGSLDGQGSEHTVDKKKYAAELHLVHWNTKYGDVGKAVQQPDGLAVLGIFLKVGSAKPGLQKVVDVLDSIKTEGKSADFTNFDPRGLLPESLDYWTYPGSLTTPPLAECVTWIVLKEPISVSSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIKASFK |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-08-06 Deposition Author(s): Andring, J.T. , Mckenna, R.