Pandda analysis group deposition -- crystal structure of zikv ns2b-ns3 protease in complex with asap-0014790-001
PDB DOI: 10.2210/pdb7hp3/pdb
Classification: VIRAL PROTEIN Organism(s): Zika Virus
Deposited: 2024-11-07 Deposition Author(s): Aschenbrenner, J.C. , Balcomb, B.H. , Chandran, A.V. , Fairhead, M. , Fearon, D. , Godoy, A.S. , Kenton, N. , Koekemoer, L. , Lee, A. , Lithgo, R.M. , Marples, P.G. , Ni, X. , Thompson, W. , Tomlinson, C.W.E. , Von Delft, F. , Walsh, M.A. , Wild, C. , Williams, E.P. , Winokan, M.
Method: X-RAY DIFFRACTION Resolution: 1.84 Å
Pandda analysis group deposition -- crystal structure of zikv ns2b-ns3 protease in complex with asap-0014790-001
Aschenbrenner, J.C. , Balcomb, B.H. , Chandran, A.V. , Fairhead, M. , Fearon, D. , Godoy, A.S. , Kenton, N. , Koekemoer, L. , Lee, A. , Lithgo, R.M. , Marples, P.G. , Ni, X. , Thompson, W. , Tomlinson, C.W.E. , Von Delft, F. , Walsh, M.A. , Wild, C. , Williams, E.P. , Winokan, M.
Primary Citation of Related Structures: 7HP3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Serine protease subunit NS2B | A | 46 | Zika Virus | SMGKSVDMYIERAGDITWEKDAEVTGNSPRLDVALDESGDFSLVEE |
| Serine protease NS3 | B | 168 | Zika Virus | MKEVKKGETTDGVYRVMTRRLLGSTQVGVGVMQEGVFHTMWHVTKGAALRSGEGRLDPYWGDVKQDLVSYCGPWKLDAAWDGLSEVQLLAVPPGERAKNIQTLPGIFKTKDGDIGAVALDYPAGTSGSPILDKCGRVIGLYGNGVVIKNGSYVSAITQGKREEETPVE |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-11-07 Deposition Author(s): Aschenbrenner, J.C. , Balcomb, B.H. , Chandran, A.V. , Fairhead, M. , Fearon, D. , Godoy, A.S. , Kenton, N. , Koekemoer, L. , Lee, A. , Lithgo, R.M. , Marples, P.G. , Ni, X. , Thompson, W. , Tomlinson, C.W.E. , Von Delft, F. , Walsh, M.A. , Wild, C. , Williams, E.P. , Winokan, M.