Pandda analysis group deposition -- crystal structure of hrp-2 pwwp domain in complex with z1741966151
PDB DOI: 10.2210/pdb7hhg/pdb
Classification: GENE REGULATION Organism(s): Homo Sapiens
Deposited: 2024-08-29 Deposition Author(s): Douangamath, A. , Fearon, D. , Osipov, E. , Strelkov, S. , Vantieghem, T. , Von Delft, F.
Pandda analysis group deposition -- crystal structure of hrp-2 pwwp domain in complex with z1741966151
Douangamath, A. , Fearon, D. , Osipov, E. , Strelkov, S. , Vantieghem, T. , Von Delft, F.
Primary Citation of Related Structures: 7HHG
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Hepatoma-derived growth factor-related protein 2 | A | 94 | Homo Sapiens | GMPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKSKDKYGKPNKRKGFNEGLWEIQNNPHASYS |
| Hepatoma-derived growth factor-related protein 2 | B | 94 | Homo Sapiens | GMPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKSKDKYGKPNKRKGFNEGLWEIQNNPHASYS |
| Hepatoma-derived growth factor-related protein 2 | C | 94 | Homo Sapiens | GMPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFPYDKSKDKYGKPNKRKGFNEGLWEIQNNPHASYS |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-08-29 Deposition Author(s): Douangamath, A. , Fearon, D. , Osipov, E. , Strelkov, S. , Vantieghem, T. , Von Delft, F.