Group deposition for crystallographic fragment screening of coxsackievirus a16 (g-10) 2a protease -- crystal structure of coxsackievirus a16 (g-10) 2a protease in complex with z954606858 (a71ev2a-x0719)
PDB DOI: 10.2210/pdb7h4c/pdb
Classification: HYDROLASE Organism(s): Coxsackievirus A16
Deposited: 2024-04-04 Deposition Author(s): Aschenbrenner, J.C. , Balcomb, B.H. , Capkin, E. , Chandran, A.V. , Fairhead, M. , Fearon, D. , Godoy, A.S. , Golding, M. , Koekemoer, L. , Lithgo, R.M. , Marples, P.G. , Ni, X. , Thompson, W. , Tomlinson, C.W.E. , Von Delft, F. , Wild, C. , Winokan, M. , Xavier, M.-A.E.
Method: X-RAY DIFFRACTION Resolution: 1.37 Å
Group deposition for crystallographic fragment screening of coxsackievirus a16 (g-10) 2a protease -- crystal structure of coxsackievirus a16 (g-10) 2a protease in complex with z954606858 (a71ev2a-x0719)
Aschenbrenner, J.C. , Balcomb, B.H. , Capkin, E. , Chandran, A.V. , Fairhead, M. , Fearon, D. , Godoy, A.S. , Golding, M. , Koekemoer, L. , Lithgo, R.M. , Marples, P.G. , Ni, X. , Thompson, W. , Tomlinson, C.W.E. , Von Delft, F. , Wild, C. , Winokan, M. , Xavier, M.-A.E.
Primary Citation of Related Structures: 7H4C
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Protease 2A | A | 150 | Coxsackievirus A16 | QEQTGGSGAIYVGNYRVVNRHLATHNDWANLVWEDSSRDLLVSSTTAQGCDTIARCDCQTGVYYCSSRRKHYPVSFSKPSLIFVEASEYYPARYQSHLMLAVGHSEPGDCGGILRCQHGVVGIVSTGGNGLVGFADVRDLLWLDEEAMEQ |
Method: X-RAY DIFFRACTION
Deposited Date: 2024-04-04 Deposition Author(s): Aschenbrenner, J.C. , Balcomb, B.H. , Capkin, E. , Chandran, A.V. , Fairhead, M. , Fearon, D. , Godoy, A.S. , Golding, M. , Koekemoer, L. , Lithgo, R.M. , Marples, P.G. , Ni, X. , Thompson, W. , Tomlinson, C.W.E. , Von Delft, F. , Wild, C. , Winokan, M. , Xavier, M.-A.E.