Crystal structure of atmbd5 mbd domain
PDB DOI: 10.2210/pdb7feo/pdb
Classification: DNA BINDING PROTEIN Organism(s): Arabidopsis Thaliana
Deposited: 2021-07-21 Deposition Author(s): Liu, K. , Min, J.R. , Structural Genomics Consortium (Sgc) , Wu, Z.B. , Zhou, M.Q.
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
Crystal structure of atmbd5 mbd domain
Liu, K. , Min, J.R. , Structural Genomics Consortium (Sgc) , Wu, Z.B. , Zhou, M.Q.
Primary Citation of Related Structures: 7FEO
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Methyl-CpG-binding domain-containing protein 5 | A | 72 | Arabidopsis Thaliana | GTPGDDNWLPPDWRTEIRVRTSGTKAGTVDKFYYEPITGRKFRSKNEVLYYLEHGTPKKKSVKTAENGDSHS |
| Methyl-CpG-binding domain-containing protein 5 | B | 72 | Arabidopsis Thaliana | GTPGDDNWLPPDWRTEIRVRTSGTKAGTVDKFYYEPITGRKFRSKNEVLYYLEHGTPKKKSVKTAENGDSHS |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-07-21 Deposition Author(s): Liu, K. , Min, J.R. , Structural Genomics Consortium (Sgc) , Wu, Z.B. , Zhou, M.Q.