The fk1 domain of fkbp51 in complex with peptide-inhibitor hit qfpfv
PDB DOI: 10.2210/pdb7ett/pdb
Classification: ISOMERASE Organism(s): Homo Sapiens , Synthetic Construct
Deposited: 2021-05-14 Deposition Author(s): Han, J.T. , He, Y.X. , Liu, H.X. , Pan, D.B. , Wang, S. , Xue, H.X. , Yao, X.J. , Zhu, Y.C.
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| peptide-inhibitor hit | B | 5 | Homo Sapiens , Synthetic Construct | QFPFV |
| Peptidyl-prolyl cis-trans isomerase FKBP5 | A | 128 | Homo Sapiens , Synthetic Construct | GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHDRNEPFVFSLGKGQVIKAWDIGVATMKKGEICHLLCKPEYAYGSAGSLPKIPSNATLFFEIELLDFKGE |
Method: X-RAY DIFFRACTION