Mooring stone-like arg114 pulls diverse bulged peptides: first insight into african swine fever virus-derived t cell epitopes presented by swine major histocompatibility complex class i
PDB DOI: 10.2210/pdb7em9/pdb
Classification: IMMUNE SYSTEM Organism(s): Sus Scrofa , Synthetic Construct
Deposited: 2021-04-13 Deposition Author(s): Ba, L. , Chai, Y. , Gan, J. , Gao, G. , Gao, G.F. , Huang, X. , Li, H. , Li, Y. , Liu, K. , Liu, P. , Liu, W.J. , Qi, J. , Qi, P. , Qiao, P. , Qiu, H.J. , Sun, Y. , Sun, Z. , Xiang, W. , Xiao, J. , Yue, C. , Zhao, Y.
Mooring stone-like arg114 pulls diverse bulged peptides: first insight into african swine fever virus-derived t cell epitopes presented by swine major histocompatibility complex class i
Ba, L. , Chai, Y. , Gan, J. , Gao, G. , Gao, G.F. , Huang, X. , Li, H. , Li, Y. , Liu, K. , Liu, P. , Liu, W.J. , Qi, J. , Qi, P. , Qiao, P. , Qiu, H.J. , Sun, Y. , Sun, Z. , Xiang, W. , Xiao, J. , Yue, C. , Zhao, Y.
Primary Citation of Related Structures: 7EM9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Leucocyte antigen | A | 275 | Sus Scrofa , Synthetic Construct | GPHSLSYFYTAVSRPDRGDSRFIAVGYVDDTQFVRFDSDAPNPRMEPRAPWIQQEGQDYWDRETRKQRDTSQTYRVGLKNLRGYYNQSEAGSHTYQSMYGCYLGPDGLLLRGYRQYAYDGADYIALNEDLRSWTAADTAAQITKRKWETANVAERRRSYLQGLCVESLREYLEMGKDTLQRAEPPKTHVTRHPSSDLGVTLRCWALGFYPKEISLTWQREGQDQSQDMELVETRPSGDGTFQKWAALVVPPGEEQSYTCHVQHEGLQEPLTLRWD |
| Beta-2-microglobulin | B | 100 | Sus Scrofa , Synthetic Construct | EFVARPPKVQVYSRHPAENGKPNYLNCYVSGFHPPQIEIDLLKNGEKMNAEQSDLSFSKDWSFYLLVHTEFTPNAVDQYSCRVKHVTLDKPKIVKWDRDH |
| SER-LEU-ASP-GLU-TYR-SER-SER-ASP-VAL | C | 9 | Sus Scrofa , Synthetic Construct | SLDEYSSDV |
Method: X-RAY DIFFRACTION