Crystal structure of mei2 rrm3 in complex with 8mer meirna
PDB DOI: 10.2210/pdb7eiu/pdb
Classification: RNA BINDING PROTEIN Organism(s): Legionella Pneumophila Subsp. Pneumophila Atcc 43290 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2021-03-31 Deposition Author(s): Lv, M.Q. , Shen, S.Y.
Crystal structure of mei2 rrm3 in complex with 8mer meirna
Primary Citation of Related Structures: 7EIU
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Meiosis protein mei2 | A | 155 | Legionella Pneumophila Subsp. Pneumophila Atcc 43290 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MDRNSVDYAQIASGIDTRTTVMIKNIPNKFTQQMLRDYIDVTNKGTYDFLYLRIDFVNKCNVGYAFINFIEPQSIITFGKARVGTQWNVFHSEKICDISYANIQGKDRLIEKFRNSCVMDENPAYRPKIFVSHGPNRGMEEPFPAPNNARRKLRS |
Meiosis protein mei2 | B | 155 | Legionella Pneumophila Subsp. Pneumophila Atcc 43290 , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | MDRNSVDYAQIASGIDTRTTVMIKNIPNKFTQQMLRDYIDVTNKGTYDFLYLRIDFVNKCNVGYAFINFIEPQSIITFGKARVGTQWNVFHSEKICDISYANIQGKDRLIEKFRNSCVMDENPAYRPKIFVSHGPNRGMEEPFPAPNNARRKLRS |
Method: X-RAY DIFFRACTION
Deposited Date: 2021-03-31 Deposition Author(s): Lv, M.Q. , Shen, S.Y.