Sib1, an effector of colletotrichum orbiculare
PDB DOI: 10.2210/pdb7eau/pdb
Classification: TOXIN Organism(s): Colletotrichum Orbiculare (Strain 104-T / Atcc 96160 / Cbs 514.97 / Lars 414 / Maff 240422)
Deposited: 2021-03-08 Deposition Author(s): Kurita, J. , Mori, M. , Ohki, S.
Method: SOLUTION NMR Resolution: N.A.
Sib1, an effector of colletotrichum orbiculare
Kurita, J. , Mori, M. , Ohki, S.
Primary Citation of Related Structures: 7EAU
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| SIN1 | A | 50 | Colletotrichum Orbiculare (Strain 104-T / Atcc 96160 / Cbs 514.97 / Lars 414 / Maff 240422) | QEGKCTAKGECQENTSGVKLFCTSGSCAKKEGQACTRNGPGSSNSASCPK |
Method: SOLUTION NMR
Deposited Date: 2021-03-08 Deposition Author(s): Kurita, J. , Mori, M. , Ohki, S.