Structure of coiled coil domain of trypanosoma brucei coronin
PDB DOI: 10.2210/pdb7dgx/pdb
Classification: CONTRACTILE PROTEIN Organism(s): Trypanosoma Brucei
Deposited: 2020-11-12 Deposition Author(s): Karade, S.S. , Parihar, P.S. , Pratap, J.V.
Structure of coiled coil domain of trypanosoma brucei coronin
Karade, S.S. , Parihar, P.S. , Pratap, J.V.
Primary Citation of Related Structures: 7DGX
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Coronin | A | 52 | Trypanosoma Brucei | EFSQLLALASLLGQQQAEVQRCREDLQKKESLVMETIAKIKALALEHHHHHH |
| Coronin | B | 52 | Trypanosoma Brucei | EFSQLLALASLLGQQQAEVQRCREDLQKKESLVMETIAKIKALALEHHHHHH |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-11-12 Deposition Author(s): Karade, S.S. , Parihar, P.S. , Pratap, J.V.