Dpbb domain of vcp-like atpase from aeropyrum pernix
PDB DOI: 10.2210/pdb7dg9/pdb
Classification: CHAPERONE Organism(s): Aeropyrum Pernix (Strain Atcc 700893 / Dsm 11879 / Jcm 9820 / Nbrc 100138 / K1)
Deposited: 2020-11-11 Deposition Author(s): Tagami, S. , Yagi, S.
Method: X-RAY DIFFRACTION Resolution: 1.602 Å
Dpbb domain of vcp-like atpase from aeropyrum pernix
Primary Citation of Related Structures: 7DG9
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Cell division control protein 48, AAA family | A | 93 | Aeropyrum Pernix (Strain Atcc 700893 / Dsm 11879 / Jcm 9820 / Nbrc 100138 / K1) | GPMANSSVELRVSEAYPRDVGRKIVRIDRQTAARLGVEVGDFVKVSKGDRSVVAVVWPLRPDDEGRGIIRMDGYLRAALGVTVGDTVTVEKAE |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-11-11 Deposition Author(s): Tagami, S. , Yagi, S.