Crystal structure of arabidopsis rdm15 tudor domain in complex with an h3k4me1 peptide
PDB DOI: 10.2210/pdb7de9/pdb
Classification: GENE REGULATION Organism(s): Arabidopsis Thaliana , Synthetic Construct
Deposited: 2020-11-03 Deposition Author(s): Du, J. , Song, Z.
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Transcriptional regulator | A | 66 | Arabidopsis Thaliana , Synthetic Construct | SLGQGKASGESLVGSRIKVWWPMDQAYYKGVVESYDAAKKKHLVIYDDGDQEILYLKNQKWSPLDE |
Histone H3.2 | P | 15 | Arabidopsis Thaliana , Synthetic Construct | ARTKQTARKSTGGKA |
Method: X-RAY DIFFRACTION