7DA6
Enterovirus 71 2a protease mutant- c110a in complex with peptide inhibitor
PDB DOI: 10.2210/pdb7da6/pdb
Classification: VIRAL PROTEIN Organism(s): Thermothelomyces Thermophila (Strain Atcc 42464 / Bcrc 31852 / Dsm 1799) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.)
Deposited: 2020-10-15 Deposition Author(s): Yang, W.Z. , Yuan, H.S.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.2 Å
Enterovirus 71 2a protease mutant- c110a in complex with peptide inhibitor
Primary Citation of Related Structures: 7DA6
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Polyprotein | A | 138 | Thermothelomyces Thermophila (Strain Atcc 42464 / Bcrc 31852 / Dsm 1799) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | SGAIYVGNFRVVNRHLATHNDWANLVWEDSSRDLLVSSTTAQGCDTIARCNCQTGVYYCNSRRKHYPVSFSKPSLIYVEASEYYPARYQSHLMLAQGHSEPGDAGGILRCQHGVVGIVSTGGNGLVGFADVRDLLWLD |
| PHE-ARG-GLY-LYS | C | 4 | Thermothelomyces Thermophila (Strain Atcc 42464 / Bcrc 31852 / Dsm 1799) , Rhodobacter Sphaeroides (Strain Atcc 17023 / Dsm 158 / Jcm 6121 / Nbrc 12203 / Ncimb 8253 / Ath 2.4.1.) | FRGK |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-10-15 Deposition Author(s): Yang, W.Z. , Yuan, H.S.