Solution structure of the methyl-cpg binding domain of mbd6 from arabidopsis thaliana
PDB DOI: 10.2210/pdb7d8k/pdb
Classification: DNA BINDING PROTEIN Organism(s): Murine Norovirus Gv/Cr6/2005/Usa
Deposited: 2020-10-08 Deposition Author(s): Mahana, Y. , Morimoto, D. , Ohki, I. , Shirakawa, M. , Sugase, K. , Walinda, E.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of the methyl-cpg binding domain of mbd6 from arabidopsis thaliana
Mahana, Y. , Morimoto, D. , Ohki, I. , Shirakawa, M. , Sugase, K. , Walinda, E.
Primary Citation of Related Structures: 7D8K
Proteins | ||||
---|---|---|---|---|
Molecule | Chains | Sequence Length | Organism | Sequence |
Methyl-CpG-binding domain-containing protein 6 | A | 68 | Murine Norovirus Gv/Cr6/2005/Usa | GPLGSDNWLPPGWRVEDKIRTSGATAGSVDKYYYEPNTGRKFRSRTEVLYYLEHGTSKRGTKKAENTY |
Method: SOLUTION NMR
Deposited Date: 2020-10-08 Deposition Author(s): Mahana, Y. , Morimoto, D. , Ohki, I. , Shirakawa, M. , Sugase, K. , Walinda, E.