Crystal structure of fip200 claw/p-ccpg1 fir2
PDB DOI: 10.2210/pdb7d0e/pdb
Classification: SIGNALING PROTEIN/PROTEIN BINDING Organism(s): Homo Sapiens
Deposited: 2020-09-09 Deposition Author(s): Pan, L.F. , Zhou, Z.X.
Crystal structure of fip200 claw/p-ccpg1 fir2
Primary Citation of Related Structures: 7D0E
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| RB1-inducible coiled-coil protein 1 | A | 105 | Homo Sapiens | SRHSEKIAIRDFQVGDLVLIILDERHDNYVLFTVSPTLYFLHSESLPALDLKPGEGASGASRRPWVLGKVMEKEYCQAKKAQNRFKVPLGTKFYRVKAVSWNKKV |
| Cell cycle progression protein 1 FIR2 | B | 13 | Homo Sapiens | SDDSDIVTLEPPK |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-09-09 Deposition Author(s): Pan, L.F. , Zhou, Z.X.