Solution structure of ncr169 oxidized form 1 from medicago truncatula
PDB DOI: 10.2210/pdb7ckd/pdb
Classification: PLANT PROTEIN Organism(s): Medicago Truncatula
Deposited: 2020-07-16 Deposition Author(s): Isozumi, N. , Masubuchi, Y. , Ohki, S.
Method: SOLUTION NMR Resolution: N.A.
Solution structure of ncr169 oxidized form 1 from medicago truncatula
Isozumi, N. , Masubuchi, Y. , Ohki, S.
Primary Citation of Related Structures: 7CKD
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Nodule Cysteine-Rich (NCR) secreted peptide | A | 39 | Medicago Truncatula | GEDIGHIKYCGIVDDCYKSKKPLFKIWKCVENVCVLWYK |
Method: SOLUTION NMR
Deposited Date: 2020-07-16 Deposition Author(s): Isozumi, N. , Masubuchi, Y. , Ohki, S.