7BWI
Solution structure of recombinant apetx1
PDB DOI: 10.2210/pdb7bwi/pdb
Classification: TOXIN Organism(s): Anthopleura Elegantissima
Deposited: 2020-04-14 Deposition Author(s): Imai, S. , Kobayashi, N. , Kurita, J. , Matsumura, K. , Nishimura, Y. , Osawa, M. , Shimada, I. , Yokogawa, M.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of recombinant apetx1
Imai, S. , Kobayashi, N. , Kurita, J. , Matsumura, K. , Nishimura, Y. , Osawa, M. , Shimada, I. , Yokogawa, M.
Primary Citation of Related Structures: 7BWI
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Kappa-actitoxin-Ael2a | A | 42 | Anthopleura Elegantissima | GTTCYCGKTIGIYWFGTKTCPSNRGYTGSCGYFLGICCYPVD |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2020-04-14 Deposition Author(s): Imai, S. , Kobayashi, N. , Kurita, J. , Matsumura, K. , Nishimura, Y. , Osawa, M. , Shimada, I. , Yokogawa, M.