7BB3
Structure of s. pombe yg-box oligomer
PDB DOI: 10.2210/pdb7bb3/pdb
Classification: SPLICING Organism(s): Legionella Pneumophila Subsp. Pneumophila Atcc 43290
Deposited: 2020-12-16 Deposition Author(s): Fischer, U. , Grimm, C. , Veepaschit, J.
Experimental Data Snapshot
Method: X-RAY DIFFRACTION Resolution: 2.158 Å
Structure of s. pombe yg-box oligomer
Fischer, U. , Grimm, C. , Veepaschit, J.
Primary Citation of Related Structures: 7BB3
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Survival motor neuron-like protein 1,Survival motor neuron-like protein 1 | A | 69 | Legionella Pneumophila Subsp. Pneumophila Atcc 43290 | MGDQSQKEVWDDSELRNAFETALHEFKKYHSIEAKGYDETYKKLIMSWYYAGYYTGLAEGLAKSEQRKD |
| Survival motor neuron-like protein 1,Survival motor neuron-like protein 1 | B | 69 | Legionella Pneumophila Subsp. Pneumophila Atcc 43290 | MGDQSQKEVWDDSELRNAFETALHEFKKYHSIEAKGYDETYKKLIMSWYYAGYYTGLAEGLAKSEQRKD |
Experimental Data
Method: X-RAY DIFFRACTION
Deposited Date: 2020-12-16 Deposition Author(s): Fischer, U. , Grimm, C. , Veepaschit, J.