Crystal structure of pafb
PDB DOI: 10.2210/pdb7bae/pdb
Classification: ANTIFUNGAL PROTEIN Organism(s): Penicillium Rubens (Strain Atcc 28089 / Dsm 1075 / Nrrl 1951 / Wisconsin 54-1255)
Deposited: 2020-12-15 Deposition Author(s): Alex, J.M. , Crowley, P.B. , Guagnini, F. , Huber, A. , Marx, F.
Method: X-RAY DIFFRACTION Resolution: 1.2 Å
Crystal structure of pafb
Alex, J.M. , Crowley, P.B. , Guagnini, F. , Huber, A. , Marx, F.
Primary Citation of Related Structures: 7BAE
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Antifungal protein | A | 58 | Penicillium Rubens (Strain Atcc 28089 / Dsm 1075 / Nrrl 1951 / Wisconsin 54-1255) | LSKFGGECSLKHNTCTYLKGGKNHVVNCGSAANKKCKSDRHHCEYDEHHKRVDCQTPV |
Method: X-RAY DIFFRACTION
Deposited Date: 2020-12-15 Deposition Author(s): Alex, J.M. , Crowley, P.B. , Guagnini, F. , Huber, A. , Marx, F.