7B7O
Solution structure of a. thaliana core tata in dhpc micelles
PDB DOI: 10.2210/pdb7b7o/pdb
Classification: MEMBRANE PROTEIN Organism(s): Arabidopsis Thaliana
Deposited: 2020-12-11 Deposition Author(s): Jakob, M. , Klosgen, R.B. , Maler, L. , Pettersson, P. , Tannert, F. , Ye, W.
Experimental Data Snapshot
Method: SOLUTION NMR Resolution: N.A.
Solution structure of a. thaliana core tata in dhpc micelles
Jakob, M. , Klosgen, R.B. , Maler, L. , Pettersson, P. , Tannert, F. , Ye, W.
Primary Citation of Related Structures: 7B7O
| Proteins | ||||
|---|---|---|---|---|
| Molecule | Chains | Sequence Length | Organism | Sequence |
| Sec-independent protein translocase protein TATA, chloroplastic | A | 53 | Arabidopsis Thaliana | ALFGLGVPELAVIAGVAALLFGPKKLPEIGKSIGKTVKSFQQAAKEFESELKT |
Experimental Data
Method: SOLUTION NMR
Deposited Date: 2020-12-11 Deposition Author(s): Jakob, M. , Klosgen, R.B. , Maler, L. , Pettersson, P. , Tannert, F. , Ye, W.